PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g038360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 393aa    MW: 44335.8 Da    PI: 9.4979
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g038360.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA529.3e-17313347135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C tt Tp+WR+gp g ktLCnaCG+++r+ +l
  Csa05g038360.1 313 CTHCETTRTPQWREGPCGRKTLCNACGVRFRSGRL 347
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004019.2E-16307357IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-14311370No hitNo description
PROSITE profilePS5011411.701311343IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-13311344IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.63E-14312369No hitNo description
PfamPF003201.3E-14313347IPR000679Zinc finger, GATA-type
PROSITE patternPS003440313338IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MNNGSWLPEE DFKGLEDNFF DNLVEHMDDI PLEDIETADD DEEDWVTGFK NLGPPPLDVL  60
TSLSSEFDCK VQRVRVHKPA TIVGEFWGSL DLFNKHKVTL KQSSSSDVSS TVDNFPPDVK  120
VSKLFQSTSP VSVLENSNGS ALSHNQNRIQ RLAFLVKGIR SKRKRPTTLR FFQSLGAEMS  180
QMFXDEIMLK QSSSSDVSST VDNFPPDVKV SKLFQSTSPV SVLENSNGSA LSQNQNRIQR  240
LAFLVKGIRS KRKRPTTLRF FQSLGAEMSQ MFVPEESESE NSAKKKRKKY RSPPQPVCHS  300
PELFNPDGTV RKCTHCETTR TPQWREGPCG RKTLCNACGV RFRSGRLVPE YRPASSPTFV  360
PTVHSNSHRK IIEMRRKDEG QLETRKIRTV TS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284288KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010510639.11e-138PREDICTED: putative GATA transcription factor 13
SwissprotQ9SKN63e-79GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLR0FY111e-101R0FY11_9BRAS; Uncharacterized protein
STRINGscaffold_401176.17e-91(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.22e-69GATA transcription factor 11